Please help us by sharing and spreading the word.
- Home
- One Perfect Shot
- One Perfect Shot Season 1 Episode 3







One Perfect Shot Season 1 Episode 3
Filmmaker Kasi Lemmons details the journey that led her to direct 2019’s Academy Award nominated Harriet and its most moving sequence, in which abolitionist Harriet Tubman crosses over state lines into freedom.
The Age of Nature
Humanity’srelationshipwithnatureandwildlifeandhowscientistsandconservationistsstudywaystorestoretheplanet.
Angela Black
Angela Black leads a seemingly idyllic life with two beautiful sons and a charming, hard-working husband while covering the fact that she is a victim of domestic violence. Until one…
Vampire Detective
Private detective Yoon San gets turned into a vampire one day while he was out on a duty. As he meets various clients and cracks cases for them, he also…
Everybody Hates Chris
The North Water
Henry Drax is a harpooner and brutish killer whose amorality has been shaped to fit the harshness of his world, who will set sail on a whaling expedition to the…
Chilling Adventures of Sabrina
As her 16th birthday nears, Sabrina must choose between the witch world of her family and the human world of her friends. Based on the Archie comic.
The Origins of Coronavirus Explained in 1 Minute
TheCOVID-19virus,oftenreferredtoastheCorona-virus,isbelievedtohaveoriginatedfromaso-calledwetmarketinWuhan,wherewildanimalshavebeenshovedintocrowdedcagesalongsideeachother,readytobekilledandcookedinfrontofcustomers.Insuchplaces,youcaneasilybeexposedtoinfectiousdiseases.Thisvideoalsoprovidesusacloserlookatthefascinatingmammal,thepangolin,thatisunfortunatelythemosttraffickedanimalspeciesintheworld.Writtenbychribren